SCOPe 2.01: Domain d1zc8y2: 1zc8 Y:313-405

Lineage for d1zc8y2 (1zc8 Y:313-405)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Thermus thermophilus [TaxId:274] [50470] (7 PDB entries)

8. Domain d1zc8y2: 1zc8 Y:313-405 [124894]
   Other proteins in same PDB: d1zc8k1, d1zc8y1, d1zc8y3
   automatically matched to d1aipa2
   protein/RNA complex

Details for d1zc8y2

PDB Entry: 1zc8, 13 Å

PDB Description: Coordinates of tmRNA, SmpB, EF-Tu and h44 fitted into Cryo-EM map of the 70S ribosome and tmRNA complex

PDB Compounds: (Y:) elongation factor tu

SCOPe Domain Sequences for d1zc8y2:

Sequence; same for both SEQRES and ATOM records:

>d1zc8y2 b.44.1.1 (Y:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

Timeline for d1zc8y2:

• d1zc8y2 first appeared in SCOP 1.73
  
• d1zc8y2 appears in SCOP 1.75
  
• d1zc8y2 appears in SCOPe 2.02
  
• d1zc8y2 appears in the current release, SCOPe 2.08