Class b: All beta proteins [48724] (174 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
Species Thermus thermophilus [TaxId:274] [50470] (7 PDB entries) |
Domain d1zc8y2: 1zc8 Y:313-405 [124894] Other proteins in same PDB: d1zc8k1, d1zc8y1, d1zc8y3 automatically matched to d1aipa2 complexed with du |
PDB Entry: 1zc8 (more details), 13 Å
SCOP Domain Sequences for d1zc8y2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc8y2 b.44.1.1 (Y:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1zc8y2: