![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.111: Small protein B (SmpB) [74981] (1 superfamily) barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold |
![]() | Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) ![]() |
![]() | Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein) |
![]() | Protein Small protein B (SmpB) [74984] (2 species) tmRNA-binding protein; SsrA-binding protein |
![]() | Species Aquifex aeolicus [TaxId:63363] [74985] (4 PDB entries) |
![]() | Domain d1zc8k1: 1zc8 K:1-130 [124892] Other proteins in same PDB: d1zc8y1, d1zc8y2, d1zc8y3 automatically matched to d1k8ha_ complexed with du |
PDB Entry: 1zc8 (more details)
SCOP Domain Sequences for d1zc8k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc8k1 b.111.1.1 (K:1-130) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]} gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv lialakgkkl
Timeline for d1zc8k1: