Lineage for d1zc8k1 (1zc8 K:1-130)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679428Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 679429Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 679430Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 679431Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 679432Species Aquifex aeolicus [TaxId:63363] [74985] (4 PDB entries)
  8. 679436Domain d1zc8k1: 1zc8 K:1-130 [124892]
    Other proteins in same PDB: d1zc8y1, d1zc8y2, d1zc8y3
    automatically matched to d1k8ha_
    complexed with du

Details for d1zc8k1

PDB Entry: 1zc8 (more details)

PDB Description: Coordinates of tmRNA, SmpB, EF-Tu and h44 fitted into Cryo-EM map of the 70S ribosome and tmRNA complex
PDB Compounds: (K:) SsrA-binding protein

SCOP Domain Sequences for d1zc8k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc8k1 b.111.1.1 (K:1-130) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]}
gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw
lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv
lialakgkkl

SCOP Domain Coordinates for d1zc8k1:

Click to download the PDB-style file with coordinates for d1zc8k1.
(The format of our PDB-style files is described here.)

Timeline for d1zc8k1: