| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins) |
| Protein Probable N-acetylglucosamine kinase CV2896, C-terminal domain [418995] (1 species) |
| Species Chromobacterium violaceum [TaxId:536] [419467] (1 PDB entry) Uniprot Q7NU07 |
| Domain d1zc6b2: 1zc6 B:122-295 [124891] Other proteins in same PDB: d1zc6a1, d1zc6b1 automated match to d1zc6a2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1zc6 (more details), 2.2 Å
SCOPe Domain Sequences for d1zc6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc6b2 c.55.1.5 (B:122-295) Probable N-acetylglucosamine kinase CV2896, C-terminal domain {Chromobacterium violaceum [TaxId: 536]}
qpgiivalgtgsigealypdgshreaggwgypsgdeasgawlgqraaqltqmaldgrhsh
spltravldfvggdwqammawngratpaqfarlaplvlsaarvdpeadallrqagedawa
iaraldpqdelpvalcgglgqalrdwlppgfrqrlvapqgdsaqgallllqrps
Timeline for d1zc6b2: