SCOPe 2.08: Domain d1zc6b1: 1zc6 B:3-121

Lineage for d1zc6b1 (1zc6 B:3-121)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins)

6. Protein Probable N-acetylglucosamine kinase CV2896, N-terminal domain [418994] (1 species)

7. Species Chromobacterium violaceum [TaxId:536] [419466] (1 PDB entry)
   Uniprot Q7NU07

8. Domain d1zc6b1: 1zc6 B:3-121 [124890]
   Other proteins in same PDB: d1zc6a2, d1zc6b2
   automated match to d1zc6a1

Details for d1zc6b1

PDB Entry: 1zc6, 2.2 Å

PDB Description: Crystal Structure of Putative N-acetylglucosamine Kinase from Chromobacterium violaceum. Northeast Structural Genomics Target Cvr23.

PDB Compounds: (B:) probable N-acetylglucosamine kinase

SCOPe Domain Sequences for d1zc6b1:

Sequence; same for both SEQRES and ATOM records:

>d1zc6b1 c.55.1.5 (B:3-121) Probable N-acetylglucosamine kinase CV2896, N-terminal domain {Chromobacterium violaceum [TaxId: 536]}
rqtmnpsiryligvdgggtgtrirlhasdgtplamaeggasalsqgiakswqavlstlea
afqqaglpaapasacaiglglsgvhnrqwagefesqapgfarlslatdgyttllgahgg

Timeline for d1zc6b1:

• d1zc6b1 first appeared in SCOP 1.73
  
• d1zc6b1 appears in SCOPe 2.07