![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins) |
![]() | Protein Probable N-acetylglucosamine kinase CV2896, N-terminal domain [418994] (1 species) |
![]() | Species Chromobacterium violaceum [TaxId:536] [419466] (1 PDB entry) Uniprot Q7NU07 |
![]() | Domain d1zc6b1: 1zc6 B:3-121 [124890] Other proteins in same PDB: d1zc6a2, d1zc6b2 automated match to d1zc6a1 |
PDB Entry: 1zc6 (more details), 2.2 Å
SCOPe Domain Sequences for d1zc6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc6b1 c.55.1.5 (B:3-121) Probable N-acetylglucosamine kinase CV2896, N-terminal domain {Chromobacterium violaceum [TaxId: 536]} rqtmnpsiryligvdgggtgtrirlhasdgtplamaeggasalsqgiakswqavlstlea afqqaglpaapasacaiglglsgvhnrqwagefesqapgfarlslatdgyttllgahgg
Timeline for d1zc6b1: