Lineage for d1zc6a2 (1zc6 A:122-292)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884457Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins)
  6. 2884504Protein Probable N-acetylglucosamine kinase CV2896, C-terminal domain [418995] (1 species)
  7. 2884505Species Chromobacterium violaceum [TaxId:536] [419467] (1 PDB entry)
    Uniprot Q7NU07
  8. 2884506Domain d1zc6a2: 1zc6 A:122-292 [124889]
    Other proteins in same PDB: d1zc6a1, d1zc6b1
    has additional insertions and/or extensions that are not grouped together

Details for d1zc6a2

PDB Entry: 1zc6 (more details), 2.2 Å

PDB Description: Crystal Structure of Putative N-acetylglucosamine Kinase from Chromobacterium violaceum. Northeast Structural Genomics Target Cvr23.
PDB Compounds: (A:) probable N-acetylglucosamine kinase

SCOPe Domain Sequences for d1zc6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc6a2 c.55.1.5 (A:122-292) Probable N-acetylglucosamine kinase CV2896, C-terminal domain {Chromobacterium violaceum [TaxId: 536]}
qpgiivalgtgsigealypdgshreaggwgypsgdeasgawlgqraaqltqmaldgrhsh
spltravldfvggdwqammawngratpaqfarlaplvlsaarvdpeadallrqagedawa
iaraldpqdelpvalcgglgqalrdwlppgfrqrlvapqgdsaqgallllq

SCOPe Domain Coordinates for d1zc6a2:

Click to download the PDB-style file with coordinates for d1zc6a2.
(The format of our PDB-style files is described here.)

Timeline for d1zc6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zc6a1