Lineage for d1zc4d_ (1zc4 D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1550802Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1551044Protein automated matches [190063] (2 species)
    not a true protein
  7. 1551064Species Norway rat (Rattus norvegicus) [TaxId:10116] [188181] (2 PDB entries)
  8. 1551067Domain d1zc4d_: 1zc4 D: [124887]
    Other proteins in same PDB: d1zc4a_, d1zc4b1, d1zc4c_
    automated match to d1zc4b1
    complexed with gnp, mg

Details for d1zc4d_

PDB Entry: 1zc4 (more details), 2.5 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala
PDB Compounds: (D:) exocyst complex protein Exo84

SCOPe Domain Sequences for d1zc4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc4d_ b.55.1.1 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkrrreq

SCOPe Domain Coordinates for d1zc4d_:

Click to download the PDB-style file with coordinates for d1zc4d_.
(The format of our PDB-style files is described here.)

Timeline for d1zc4d_: