Lineage for d1zc4d1 (1zc4 D:171-283)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805152Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
    Pfam PF00169
  6. 805227Protein Exocyst complex protein EXO84 [141399] (1 species)
  7. 805228Species Rat (Rattus norvegicus) [TaxId:10116] [141400] (2 PDB entries)
    Uniprot O54924 171-283
  8. 805232Domain d1zc4d1: 1zc4 D:171-283 [124887]
    Other proteins in same PDB: d1zc4a1, d1zc4c1
    automatically matched to 1ZC4 B:171-283
    complexed with gnp, mg; mutant

Details for d1zc4d1

PDB Entry: 1zc4 (more details), 2.5 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala
PDB Compounds: (D:) exocyst complex protein Exo84

SCOP Domain Sequences for d1zc4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc4d1 b.55.1.1 (D:171-283) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]}
gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkrrreq

SCOP Domain Coordinates for d1zc4d1:

Click to download the PDB-style file with coordinates for d1zc4d1.
(The format of our PDB-style files is described here.)

Timeline for d1zc4d1: