SCOP 1.73: Domain d1zc4c1: 1zc4 C:11-183

Lineage for d1zc4c1 (1zc4 C:11-183)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries)

8. Domain d1zc4c1: 1zc4 C:11-183 [124886]
   Other proteins in same PDB: d1zc4b1, d1zc4d1
   automatically matched to 1ZC3 A:11-183
   complexed with gnp, mg; mutant

Details for d1zc4c1

PDB Entry: 1zc4, 2.5 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala

PDB Compounds: (C:) Ras-related protein Ral-A

SCOP Domain Sequences for d1zc4c1:

Sequence; same for both SEQRES and ATOM records:

>d1zc4c1 c.37.1.8 (C:11-183) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds

Timeline for d1zc4c1:

• d1zc4c1 is new in SCOP 1.73
  
• d1zc4c1 appears in SCOP 1.75
  
• d1zc4c1 appears in the current release, SCOPe 2.08, called d1zc4c_