Lineage for d1zc4c_ (1zc4 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867769Protein Ras-related protein RalA [89662] (2 species)
  7. 2867777Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries)
  8. 2867785Domain d1zc4c_: 1zc4 C: [124886]
    Other proteins in same PDB: d1zc4b1, d1zc4d_
    automated match to d1uada_
    complexed with gnp, mg

Details for d1zc4c_

PDB Entry: 1zc4 (more details), 2.5 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala
PDB Compounds: (C:) Ras-related protein Ral-A

SCOPe Domain Sequences for d1zc4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc4c_ c.37.1.8 (C:) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds

SCOPe Domain Coordinates for d1zc4c_:

Click to download the PDB-style file with coordinates for d1zc4c_.
(The format of our PDB-style files is described here.)

Timeline for d1zc4c_: