SCOPe 2.06: Domain d1zc4b1: 1zc4 B:171-283

Lineage for d1zc4b1 (1zc4 B:171-283)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Exocyst complex protein EXO84 [141399] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [141400] (1 PDB entry)
   Uniprot O54924 171-283

8. Domain d1zc4b1: 1zc4 B:171-283 [124885]
   Other proteins in same PDB: d1zc4a_, d1zc4c_, d1zc4d_
   complexed with gnp, mg

Details for d1zc4b1

PDB Entry: 1zc4, 2.5 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala

PDB Compounds: (B:) exocyst complex protein Exo84

SCOPe Domain Sequences for d1zc4b1:

Sequence; same for both SEQRES and ATOM records:

>d1zc4b1 b.55.1.1 (B:171-283) Exocyst complex protein EXO84 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkrrreq

Timeline for d1zc4b1:

• d1zc4b1 first appeared in SCOP 1.73
  
• d1zc4b1 appears in SCOPe 2.05
  
• d1zc4b1 appears in SCOPe 2.07
  
• d1zc4b1 appears in the current release, SCOPe 2.08