Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (13 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins) Pfam PF00169 |
Protein Exocyst complex protein EXO84 [141399] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [141400] (2 PDB entries) Uniprot O54924 171-283 |
Domain d1zc3d1: 1zc3 D:171-279 [124883] Other proteins in same PDB: d1zc3a1, d1zc3c1 automatically matched to 1ZC4 B:171-283 complexed with gnp, mg; mutant |
PDB Entry: 1zc3 (more details), 2 Å
SCOP Domain Sequences for d1zc3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc3d1 b.55.1.1 (D:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr
Timeline for d1zc3d1: