SCOP 1.75: Domain d1zc3d1: 1zc3 D:171-279

Lineage for d1zc3d1 (1zc3 D:171-279)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (13 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
   Pfam PF00169

6. Protein Exocyst complex protein EXO84 [141399] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [141400] (2 PDB entries)
   Uniprot O54924 171-283

8. Domain d1zc3d1: 1zc3 D:171-279 [124883]
   Other proteins in same PDB: d1zc3a1, d1zc3c1
   automatically matched to 1ZC4 B:171-283
   complexed with gnp, mg; mutant

Details for d1zc3d1

PDB Entry: 1zc3, 2 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala

PDB Compounds: (D:) exocyst complex protein Exo84

SCOP Domain Sequences for d1zc3d1:

Sequence; same for both SEQRES and ATOM records:

>d1zc3d1 b.55.1.1 (D:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]}
gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr

Timeline for d1zc3d1:

• d1zc3d1 first appeared in SCOP 1.73
  
• d1zc3d1 is called d1zc3d_ in SCOPe 2.01
  
• d1zc3d1 appears in the current release, SCOPe 2.08, called d1zc3d_