Lineage for d1zc3d_ (1zc3 D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. Protein automated matches [190063] (3 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188181] (2 PDB entries)
  8. Domain d1zc3d_: 1zc3 D: [124883]
    Other proteins in same PDB: d1zc3a1, d1zc3c_
    automated match to d1zc3b1
    complexed with gnp, mg

Details for d1zc3d_

PDB Entry: 1zc3 (more details), 2 Å

PDB Description: Crystal structure of the Ral-binding domain of Exo84 in complex with the active RalA
PDB Compounds: (D:) exocyst complex protein Exo84

SCOPe Domain Sequences for d1zc3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc3d_ b.55.1.1 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr

SCOPe Domain Coordinates for d1zc3d_ are not available.

Timeline for d1zc3d_:

Domains from other chains:
(mouse over for more information)
d1zc3a1, d1zc3b_, d1zc3c_