Lineage for d1zc3c1 (1zc3 C:11-183)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830629Protein Ras-related protein RalA [89662] (2 species)
  7. 830637Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries)
  8. 830641Domain d1zc3c1: 1zc3 C:11-183 [124882]
    Other proteins in same PDB: d1zc3b1, d1zc3d1
    automatically matched to 1ZC3 A:11-183
    complexed with gnp, mg; mutant

Details for d1zc3c1

PDB Entry: 1zc3 (more details), 2 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala
PDB Compounds: (C:) Ras-related protein Ral-A

SCOP Domain Sequences for d1zc3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc3c1 c.37.1.8 (C:11-183) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds

SCOP Domain Coordinates for d1zc3c1:

Click to download the PDB-style file with coordinates for d1zc3c1.
(The format of our PDB-style files is described here.)

Timeline for d1zc3c1: