Lineage for d1zbya1 (1zby A:4-294)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644948Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 644949Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 644950Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 644965Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 644966Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (112 PDB entries)
  8. 644969Domain d1zbya1: 1zby A:4-294 [124878]
    automatically matched to d1koka_
    complexed with hem

Details for d1zbya1

PDB Entry: 1zby (more details), 1.2 Å

PDB Description: High-Resolution Crystal Structure of Native (Resting) Cytochrome c Peroxidase (CcP)
PDB Compounds: (A:) cytochrome c peroxidase

SCOP Domain Sequences for d1zbya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbya1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1zbya1:

Click to download the PDB-style file with coordinates for d1zbya1.
(The format of our PDB-style files is described here.)

Timeline for d1zbya1: