Lineage for d1zbxb1 (1zbx B:485-613)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617035Fold d.339: ORC1-binding domain [144004] (1 superfamily)
    complex fold, composed of an alpha hairpin, meander beta-sheet and a five-stranded barrel of unusual topology
  4. 2617036Superfamily d.339.1: ORC1-binding domain [144005] (1 family) (S)
    automatically mapped to Pfam PF11603
  5. 2617037Family d.339.1.1: ORC1-binding domain [144006] (1 protein)
  6. 2617038Protein Regulatory protein SIR1 [144007] (1 species)
  7. 2617039Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144008] (3 PDB entries)
    Uniprot P21691 484-611! Uniprot P21691 485-613! Uniprot P21691 487-611
  8. 2617043Domain d1zbxb1: 1zbx B:485-613 [124877]
    Other proteins in same PDB: d1zbxa1, d1zbxb2

Details for d1zbxb1

PDB Entry: 1zbx (more details), 2.5 Å

PDB Description: crystal structure of a orc1p-sir1p complex
PDB Compounds: (B:) Regulatory protein SIR1

SCOPe Domain Sequences for d1zbxb1:

Sequence, based on SEQRES records: (download)

>d1zbxb1 d.339.1.1 (B:485-613) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
teeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyq
dpiplkaktlfkfckqikkkflrgadfklhtlpteanlkyepermtvlcscvpillddqt
vqylyddsl

Sequence, based on observed residues (ATOM records): (download)

>d1zbxb1 d.339.1.1 (B:485-613) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
teeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyq
dpiplkaktlfkfckqikkkflrgadfklhtlpmtvlcscvpillddqtvqylyddsl

SCOPe Domain Coordinates for d1zbxb1:

Click to download the PDB-style file with coordinates for d1zbxb1.
(The format of our PDB-style files is described here.)

Timeline for d1zbxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zbxb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zbxa1