SCOPe 2.08: Domain d1zbxb1: 1zbx B:485-613

Lineage for d1zbxb1 (1zbx B:485-613)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.339: ORC1-binding domain [144004] (1 superfamily)
   complex fold, composed of an alpha hairpin, meander beta-sheet and a five-stranded barrel of unusual topology

4. Superfamily d.339.1: ORC1-binding domain [144005] (1 family)
   automatically mapped to Pfam PF11603

5. Family d.339.1.1: ORC1-binding domain [144006] (1 protein)

6. Protein Regulatory protein SIR1 [144007] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144008] (3 PDB entries)
   Uniprot P21691 484-611! Uniprot P21691 485-613! Uniprot P21691 487-611

8. Domain d1zbxb1: 1zbx B:485-613 [124877]
   Other proteins in same PDB: d1zbxa1, d1zbxb2

Details for d1zbxb1

PDB Entry: 1zbx, 2.5 Å

PDB Description: crystal structure of a orc1p-sir1p complex

PDB Compounds: (B:) Regulatory protein SIR1

SCOPe Domain Sequences for d1zbxb1:

Sequence, based on SEQRES records:

>d1zbxb1 d.339.1.1 (B:485-613) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
teeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyq
dpiplkaktlfkfckqikkkflrgadfklhtlpteanlkyepermtvlcscvpillddqt
vqylyddsl

Sequence, based on observed residues (ATOM records):

>d1zbxb1 d.339.1.1 (B:485-613) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
teeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyq
dpiplkaktlfkfckqikkkflrgadfklhtlpmtvlcscvpillddqtvqylyddsl

Timeline for d1zbxb1:

• d1zbxb1 first appeared in SCOP 1.73
  
• d1zbxb1 appears in SCOPe 2.07