Lineage for d1zbwa2 (1zbw A:240-307)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720743Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 720748Species Goat (Capra hircus) [TaxId:9925] [89883] (14 PDB entries)
  8. 720754Domain d1zbwa2: 1zbw A:240-307 [124875]
    Other proteins in same PDB: d1zbwa1
    automatically matched to d1ljya2
    complexed with nag

Details for d1zbwa2

PDB Entry: 1zbw (more details), 2.8 Å

PDB Description: crystal structure of the complex formed between signalling protein from goat mammary gland (spg-40) and a tripeptide trp-pro-trp at 2.8a resolution
PDB Compounds: (A:) chitinase-3 like protein 1

SCOP Domain Sequences for d1zbwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbwa2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
fgrsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOP Domain Coordinates for d1zbwa2:

Click to download the PDB-style file with coordinates for d1zbwa2.
(The format of our PDB-style files is described here.)

Timeline for d1zbwa2: