SCOP 1.75: Domain d1zbva2: 1zbv A:240-307

Lineage for d1zbva2 (1zbv A:240-307)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Goat (Capra hircus) [TaxId:9925] [89883] (14 PDB entries)

8. Domain d1zbva2: 1zbv A:240-307 [124873]
   Other proteins in same PDB: d1zbva1
   automatically matched to d1ljya2
   complexed with nag

Details for d1zbva2

PDB Entry: 1zbv, 3.21 Å

PDB Description: crystal structure of the goat signalling protein (spg-40) complexed with a designed peptide trp-pro-trp at 3.2a resolution

PDB Compounds: (A:) chitinase-3 like protein 1

SCOP Domain Sequences for d1zbva2:

Sequence; same for both SEQRES and ATOM records:

>d1zbva2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
fgrsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d1zbva2:

• d1zbva2 first appeared in SCOP 1.73
  
• d1zbva2 appears in SCOPe 2.01
  
• d1zbva2 appears in the current release, SCOPe 2.08