Lineage for d1zbva2 (1zbv A:240-307)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2942022Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2942036Species Goat (Capra hircus) [TaxId:9925] [89883] (14 PDB entries)
  8. 2942050Domain d1zbva2: 1zbv A:240-307 [124873]
    Other proteins in same PDB: d1zbva1
    automatically matched to d1ljya2

Details for d1zbva2

PDB Entry: 1zbv (more details), 3.21 Å

PDB Description: crystal structure of the goat signalling protein (spg-40) complexed with a designed peptide trp-pro-trp at 3.2a resolution
PDB Compounds: (A:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1zbva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbva2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
fgrsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOPe Domain Coordinates for d1zbva2:

Click to download the PDB-style file with coordinates for d1zbva2.
(The format of our PDB-style files is described here.)

Timeline for d1zbva2: