Lineage for d1zbsa2 (1zbs A:1-107)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884457Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins)
  6. Protein Hypothetical protein PG1100, N-terminal domain [418990] (1 species)
  7. Species Porphyromonas gingivalis [TaxId:837] [419462] (1 PDB entry)
    Uniprot Q7MVG4
  8. 2884483Domain d1zbsa2: 1zbs A:1-107 [124871]
    Other proteins in same PDB: d1zbsa1

Details for d1zbsa2

PDB Entry: 1zbs (more details), 2.3 Å

PDB Description: crystal structure of the putative n-acetylglucosamine kinase (pg1100) from porphyromonas gingivalis, northeast structural genomics target pgr18
PDB Compounds: (A:) hypothetical protein PG1100

SCOPe Domain Sequences for d1zbsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbsa2 c.55.1.5 (A:1-107) Hypothetical protein PG1100, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
miligdsgstktdwciakegkslgrfqtsginpfqqdrneidtalrsevlpaigqkassi
ravyfygagctpakapmlnealdsmlphcdrievagdmlgaaralcg

SCOPe Domain Coordinates for d1zbsa2:

Click to download the PDB-style file with coordinates for d1zbsa2.
(The format of our PDB-style files is described here.)

Timeline for d1zbsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zbsa1