![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins) |
![]() | Domain d1zbsa2: 1zbs A:1-107 [124871] Other proteins in same PDB: d1zbsa1 |
PDB Entry: 1zbs (more details), 2.3 Å
SCOPe Domain Sequences for d1zbsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zbsa2 c.55.1.5 (A:1-107) Hypothetical protein PG1100, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} miligdsgstktdwciakegkslgrfqtsginpfqqdrneidtalrsevlpaigqkassi ravyfygagctpakapmlnealdsmlphcdrievagdmlgaaralcg
Timeline for d1zbsa2: