SCOP 1.73: Domain d1zbrb1: 1zbr B:3-341

Lineage for d1zbrb1 (1zbr B:3-341)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (7 families)

5. Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (2 proteins)
   Pfam PF04371; functionally related to the amidinotransferase, similar active site

6. Protein Putative peptidyl-arginine deiminase [111158] (3 species)

7. Species Porphyromonas gingivalis [TaxId:837] [143808] (1 PDB entry)

8. Domain d1zbrb1: 1zbr B:3-341 [124869]
   automatically matched to 1ZBR A:3-341

Details for d1zbrb1

PDB Entry: 1zbr, 2.6 Å

PDB Description: crystal structure of the putative arginine deiminase from porphyromonas gingivalis, northeast structural genomics target pgr3

PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d1zbrb1:

Sequence; same for both SEQRES and ATOM records:

>d1zbrb1 d.126.1.6 (B:3-341) Putative peptidyl-arginine deiminase {Porphyromonas gingivalis [TaxId: 837]}
krlflpewapqeavqltwphdrtdwaymldevetcfvriatailrherlivvcpdrkrvf
gllppelhhrlycfelpsndtwardhggislladgrpmiadfafngwgmkfaahhdnlit
rrlhalglfaegvtldnrlafvleggaletdgegtllttdsclfepnrnaglsrtaiidt
lkeslgvsrvlslrhgalagddtdghidtlarfvdtrtivyvrsedpsdehysdltameq
elkelrrpdgqpyrlvplpmaealydgadrlpatyanfliingavlvptydshldavals
vmqglfpdrevigidcrplvkqhgslhcvtmqypqgfir

Timeline for d1zbrb1:

• d1zbrb1 is new in SCOP 1.73
  
• d1zbrb1 appears in SCOP 1.75
  
• d1zbrb1 appears in the current release, SCOPe 2.08, called d1zbrb_