SCOPe 2.08: Domain d1zbrb_: 1zbr B:

Lineage for d1zbrb_ (1zbr B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.0: automated matches [191334] (1 protein)
   not a true family

6. Protein automated matches [190175] (10 species)
   not a true protein

7. Species Porphyromonas gingivalis [TaxId:242619] [186905] (1 PDB entry)

8. Domain d1zbrb_: 1zbr B: [124869]
   Other proteins in same PDB: d1zbra1
   automated match to d1x72a_

Details for d1zbrb_

PDB Entry: 1zbr, 2.6 Å

PDB Description: crystal structure of the putative arginine deiminase from porphyromonas gingivalis, northeast structural genomics target pgr3

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1zbrb_:

Sequence; same for both SEQRES and ATOM records:

>d1zbrb_ d.126.1.0 (B:) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
krlflpewapqeavqltwphdrtdwaymldevetcfvriatailrherlivvcpdrkrvf
gllppelhhrlycfelpsndtwardhggislladgrpmiadfafngwgmkfaahhdnlit
rrlhalglfaegvtldnrlafvleggaletdgegtllttdsclfepnrnaglsrtaiidt
lkeslgvsrvlslrhgalagddtdghidtlarfvdtrtivyvrsedpsdehysdltameq
elkelrrpdgqpyrlvplpmaealydgadrlpatyanfliingavlvptydshldavals
vmqglfpdrevigidcrplvkqhgslhcvtmqypqgfir

Timeline for d1zbrb_:

• d1zbrb_ first appeared in SCOP 1.73, called d1zbrb1
  
• d1zbrb_ appears in SCOPe 2.07