Lineage for d1zbrb_ (1zbr B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537906Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2537907Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2538050Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2538051Protein automated matches [190175] (10 species)
    not a true protein
  7. 2538116Species Porphyromonas gingivalis [TaxId:242619] [186905] (1 PDB entry)
  8. 2538117Domain d1zbrb_: 1zbr B: [124869]
    Other proteins in same PDB: d1zbra1
    automated match to d1x72a_

Details for d1zbrb_

PDB Entry: 1zbr (more details), 2.6 Å

PDB Description: crystal structure of the putative arginine deiminase from porphyromonas gingivalis, northeast structural genomics target pgr3
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1zbrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbrb_ d.126.1.0 (B:) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
krlflpewapqeavqltwphdrtdwaymldevetcfvriatailrherlivvcpdrkrvf
gllppelhhrlycfelpsndtwardhggislladgrpmiadfafngwgmkfaahhdnlit
rrlhalglfaegvtldnrlafvleggaletdgegtllttdsclfepnrnaglsrtaiidt
lkeslgvsrvlslrhgalagddtdghidtlarfvdtrtivyvrsedpsdehysdltameq
elkelrrpdgqpyrlvplpmaealydgadrlpatyanfliingavlvptydshldavals
vmqglfpdrevigidcrplvkqhgslhcvtmqypqgfir

SCOPe Domain Coordinates for d1zbrb_:

Click to download the PDB-style file with coordinates for d1zbrb_.
(The format of our PDB-style files is described here.)

Timeline for d1zbrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zbra1