Lineage for d1zbqe_ (1zbq E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842658Protein Peroxisomal multifunctional enzyme type 2 [141900] (1 species)
    17-beta-hydroxysteroid dehydrogenase 4
  7. 2842659Species Human (Homo sapiens) [TaxId:9606] [141901] (1 PDB entry)
    Uniprot P51659 2-303
    the structure of C-terminal domain is also known, PDB entry 1S9C
  8. 2842664Domain d1zbqe_: 1zbq E: [124866]
    automated match to d1zbqa1
    complexed with nad

    has additional insertions and/or extensions that are not grouped together

Details for d1zbqe_

PDB Entry: 1zbq (more details), 2.71 Å

PDB Description: crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with nad
PDB Compounds: (E:) 17-beta-hydroxysteroid dehydrogenase 4

SCOPe Domain Sequences for d1zbqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbqe_ c.2.1.2 (E:) Peroxisomal multifunctional enzyme type 2 {Human (Homo sapiens) [TaxId: 9606]}
splrfdgrvvlvtgagaglgrayalafaergalvvvndlggdfkgvgkgslaadkvveei
rrrggkavanydsveegekvvktaldafgridvvvnnagilrdrsfarisdedwdiihrv
hlrgsfqvtraawehmkkqkygriimtssasgiygnfgqanysaaklgllglanslaieg
rksnihcntiapnagsrmtqtvmpedlvealkpeyvaplvlwlchesceengglfevgag
wigklrwertlgaivrqknhpmtpeavkanwkkicdfenaskpqsiqestgsiievlski
ds

SCOPe Domain Coordinates for d1zbqe_:

Click to download the PDB-style file with coordinates for d1zbqe_.
(The format of our PDB-style files is described here.)

Timeline for d1zbqe_: