SCOPe 2.08: Domain d1zbqe_: 1zbq E:

Lineage for d1zbqe_ (1zbq E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Peroxisomal multifunctional enzyme type 2 [141900] (1 species)
   17-beta-hydroxysteroid dehydrogenase 4

7. Species Human (Homo sapiens) [TaxId:9606] [141901] (1 PDB entry)
   Uniprot P51659 2-303
   the structure of C-terminal domain is also known, PDB entry 1S9C

8. Domain d1zbqe_: 1zbq E: [124866]
   automated match to d1zbqa1
   complexed with nad
   has additional insertions and/or extensions that are not grouped together

Details for d1zbqe_

PDB Entry: 1zbq, 2.71 Å

PDB Description: crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with nad

PDB Compounds: (E:) 17-beta-hydroxysteroid dehydrogenase 4

SCOPe Domain Sequences for d1zbqe_:

Sequence; same for both SEQRES and ATOM records:

>d1zbqe_ c.2.1.2 (E:) Peroxisomal multifunctional enzyme type 2 {Human (Homo sapiens) [TaxId: 9606]}
splrfdgrvvlvtgagaglgrayalafaergalvvvndlggdfkgvgkgslaadkvveei
rrrggkavanydsveegekvvktaldafgridvvvnnagilrdrsfarisdedwdiihrv
hlrgsfqvtraawehmkkqkygriimtssasgiygnfgqanysaaklgllglanslaieg
rksnihcntiapnagsrmtqtvmpedlvealkpeyvaplvlwlchesceengglfevgag
wigklrwertlgaivrqknhpmtpeavkanwkkicdfenaskpqsiqestgsiievlski
ds

Timeline for d1zbqe_:

• d1zbqe_ first appeared in SCOP 1.73, called d1zbqe1
  
• d1zbqe_ appears in SCOPe 2.07