![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Peroxisomal multifunctional enzyme type 2 [141900] (1 species) 17-beta-hydroxysteroid dehydrogenase 4 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141901] (1 PDB entry) Uniprot P51659 2-303 the structure of C-terminal domain is also known, PDB entry 1S9C |
![]() | Domain d1zbqb_: 1zbq B: [124863] automated match to d1zbqa1 complexed with nad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1zbq (more details), 2.71 Å
SCOPe Domain Sequences for d1zbqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zbqb_ c.2.1.2 (B:) Peroxisomal multifunctional enzyme type 2 {Human (Homo sapiens) [TaxId: 9606]} splrfdgrvvlvtgagaglgrayalafaergalvvvndlggdfkgvgkgslaadkvveei rrrggkavanydsveegekvvktaldafgridvvvnnagilrdrsfarisdedwdiihrv hlrgsfqvtraawehmkkqkygriimtssasgiygnfgqanysaaklgllglanslaieg rksnihcntiapnagsrmtqtvmpedlvealkpeyvaplvlwlchesceengglfevgag wigklrwertlgaivrqknhpmtpeavkanwkkicdfenaskpqsiqestgsiievlski ds
Timeline for d1zbqb_: