![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
![]() | Family b.122.1.10: LON domain-like [141723] (3 proteins) Pfam PF02190 |
![]() | Protein Hypothetical protein BPP1347 [141726] (1 species) identical sequence to BP2131 and BB2413 from other Bordetella species |
![]() | Species Bordetella parapertussis [TaxId:519] [141727] (1 PDB entry) Uniprot Q7WAM7 2-198 |
![]() | Domain d1zboa1: 1zbo A:2-198 [124859] Other proteins in same PDB: d1zbob_ |
PDB Entry: 1zbo (more details), 2.6 Å
SCOPe Domain Sequences for d1zboa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]} aeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrev laragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevp pelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarll llppldrlreidavlaa
Timeline for d1zboa1: