SCOP 1.75: Domain d1zboa1: 1zbo A:2-198

Lineage for d1zboa1 (1zbo A:2-198)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (13 families)

5. Family b.122.1.10: LON domain-like [141723] (2 proteins)
   Pfam PF02190

6. Protein Hypothetical protein BPP1347 [141726] (1 species)
   identical sequence to BP2131 and BB2413 from other Bordetella species

7. Species Bordetella parapertussis [TaxId:519] [141727] (1 PDB entry)
   Uniprot Q7WAM7 2-198

8. Domain d1zboa1: 1zbo A:2-198 [124859]

Details for d1zboa1

PDB Entry: 1zbo, 2.6 Å

PDB Description: x-ray crystal structure of protein bpp1347 from bordetella parapertussis. northeast structural genomics consortium target bor27.

PDB Compounds: (A:) hypothetical protein BPP1347

SCOP Domain Sequences for d1zboa1:

Sequence; same for both SEQRES and ATOM records:

>d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]}
aeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrev
laragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevp
pelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarll
llppldrlreidavlaa

Timeline for d1zboa1:

• d1zboa1 first appeared in SCOP 1.73
  
• d1zboa1 appears in SCOPe 2.01
  
• d1zboa1 appears in the current release, SCOPe 2.08