Lineage for d1zboa1 (1zbo A:2-198)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680488Family b.122.1.10: LON domain-like [141723] (2 proteins)
    Pfam PF02190
  6. 680499Protein Hypothetical protein BPP1347 [141726] (1 species)
    identical sequence to BP2131 and BB2413 from other Bordetella species
  7. 680500Species Bordetella parapertussis [TaxId:519] [141727] (1 PDB entry)
  8. 680501Domain d1zboa1: 1zbo A:2-198 [124859]

Details for d1zboa1

PDB Entry: 1zbo (more details), 2.6 Å

PDB Description: x-ray crystal structure of protein bpp1347 from bordetella parapertussis. northeast structural genomics consortium target bor27.
PDB Compounds: (A:) hypothetical protein BPP1347

SCOP Domain Sequences for d1zboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]}
aeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrev
laragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevp
pelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarll
llppldrlreidavlaa

SCOP Domain Coordinates for d1zboa1:

Click to download the PDB-style file with coordinates for d1zboa1.
(The format of our PDB-style files is described here.)

Timeline for d1zboa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zbob1