Lineage for d1zboa1 (1zbo A:2-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824048Family b.122.1.10: LON domain-like [141723] (3 proteins)
    Pfam PF02190
  6. 2824059Protein Hypothetical protein BPP1347 [141726] (1 species)
    identical sequence to BP2131 and BB2413 from other Bordetella species
  7. 2824060Species Bordetella parapertussis [TaxId:519] [141727] (1 PDB entry)
    Uniprot Q7WAM7 2-198
  8. 2824061Domain d1zboa1: 1zbo A:2-198 [124859]
    Other proteins in same PDB: d1zbob_
    has additional subdomain(s) that are not in the common domain

Details for d1zboa1

PDB Entry: 1zbo (more details), 2.6 Å

PDB Description: x-ray crystal structure of protein bpp1347 from bordetella parapertussis. northeast structural genomics consortium target bor27.
PDB Compounds: (A:) hypothetical protein BPP1347

SCOPe Domain Sequences for d1zboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]}
aeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrev
laragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevp
pelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarll
llppldrlreidavlaa

SCOPe Domain Coordinates for d1zboa1:

Click to download the PDB-style file with coordinates for d1zboa1.
(The format of our PDB-style files is described here.)

Timeline for d1zboa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zbob_