SCOP 1.75: Domain d1zbma1: 1zbm A:2-261

Lineage for d1zbma1 (1zbm A:2-261)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Hypothetical protein AF1704 [142810] (1 species)
   member of Pfam PF02642 (DUF191)

7. Species Archaeoglobus fulgidus [TaxId:2234] [142811] (1 PDB entry)
   Uniprot O28569 2-261

8. Domain d1zbma1: 1zbm A:2-261 [124858]

Details for d1zbma1

PDB Entry: 1zbm, 2.3 Å

PDB Description: x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a.

PDB Compounds: (A:) hypothetical protein AF1704

SCOP Domain Sequences for d1zbma1:

Sequence; same for both SEQRES and ATOM records:

>d1zbma1 c.94.1.1 (A:2-261) Hypothetical protein AF1704 {Archaeoglobus fulgidus [TaxId: 2234]}
kirvahtpdaddafmfyamthgkvdtwleiehviedietlnrkafnaeyevtaisahaya
llddkyrilsagasvgdgygpvvvakseisldgkriavpgryttanlllklavedfepve
mpfdriiqavldeevdagllihegqityadyglkcvldlwdwwseqvklplplglnairr
dlsvevqeeflramresiafaienpdeaieyamkysrgldrerakrfammyvndytynmp
esvdaalkklyemaeakgli

Timeline for d1zbma1:

• d1zbma1 first appeared in SCOP 1.73
  
• d1zbma1 appears in SCOPe 2.01
  
• d1zbma1 appears in the current release, SCOPe 2.08