Lineage for d1zblb_ (1zbl B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139125Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2139371Protein automated matches [190266] (7 species)
    not a true protein
  7. 2139372Species Bacillus halodurans [TaxId:272558] [188179] (2 PDB entries)
  8. 2139375Domain d1zblb_: 1zbl B: [124857]
    Other proteins in same PDB: d1zbla1
    automated match to d1zbla1
    protein/DNA complex; protein/RNA complex; complexed with mg; mutant

Details for d1zblb_

PDB Entry: 1zbl (more details), 2.2 Å

PDB Description: bacillus halodurans rnase h catalytic domain mutant d192n in complex with 12-mer rna/dna hybrid
PDB Compounds: (B:) ribonuclease H-related protein

SCOPe Domain Sequences for d1zblb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zblb_ c.55.3.1 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikany

SCOPe Domain Coordinates for d1zblb_:

Click to download the PDB-style file with coordinates for d1zblb_.
(The format of our PDB-style files is described here.)

Timeline for d1zblb_: