| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
| Protein automated matches [190266] (7 species) not a true protein |
| Species Bacillus halodurans [TaxId:272558] [188179] (2 PDB entries) |
| Domain d1zblb_: 1zbl B: [124857] Other proteins in same PDB: d1zbla1 automated match to d1zbla1 protein/DNA complex; protein/RNA complex; complexed with mg; mutant |
PDB Entry: 1zbl (more details), 2.2 Å
SCOPe Domain Sequences for d1zblb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zblb_ c.55.3.1 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikany
Timeline for d1zblb_: