![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (4 proteins) |
![]() | Protein BH0863-like Ribonuclease H [142490] (1 species) new class of RNase H |
![]() | Species Bacillus halodurans [TaxId:86665] [142491] (12 PDB entries) Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193 BH0863 |
![]() | Domain d1zbla1: 1zbl A:62-193 [124856] complexed with mg; mutant |
PDB Entry: 1zbl (more details), 2.2 Å
SCOP Domain Sequences for d1zbla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zbla1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk ernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw qtdkwgeikany
Timeline for d1zbla1: