SCOPe 2.08: Domain d1zbla1: 1zbl A:62-193

Lineage for d1zbla1 (1zbl A:62-193)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein BH0863-like Ribonuclease H [142490] (3 species)
   new class of RNase H

7. Species Bacillus halodurans [TaxId:86665] [142491] (21 PDB entries)
   Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
   BH0863

8. Domain d1zbla1: 1zbl A:62-193 [124856]
   Other proteins in same PDB: d1zblb_
   protein/DNA complex; protein/RNA complex; complexed with mg; mutant

Details for d1zbla1

PDB Entry: 1zbl, 2.2 Å

PDB Description: bacillus halodurans rnase h catalytic domain mutant d192n in complex with 12-mer rna/dna hybrid

PDB Compounds: (A:) ribonuclease H-related protein

SCOPe Domain Sequences for d1zbla1:

Sequence; same for both SEQRES and ATOM records:

>d1zbla1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikany

Timeline for d1zbla1:

• d1zbla1 first appeared in SCOP 1.73
  
• d1zbla1 appears in SCOPe 2.07