SCOPe 2.04: Domain d1zbib_: 1zbi B:

Lineage for d1zbib_ (1zbi B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein automated matches [190266] (7 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [188179] (2 PDB entries)

8. Domain d1zbib_: 1zbi B: [124854]
   automated match to d1zbfa1
   protein/DNA complex; protein/RNA complex; complexed with mg; mutant

Details for d1zbib_

PDB Entry: 1zbi, 1.85 Å

PDB Description: bacillus halodurans rnase h catalytic domain mutant d132n in complex with 12-mer rna/dna hybrid

PDB Compounds: (B:) ribonuclease H-related protein

SCOPe Domain Sequences for d1zbib_:

Sequence; same for both SEQRES and ATOM records:

>d1zbib_ c.55.3.1 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
akeeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglr
ylkernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpi
lkwqtdkwgeikadyg

Timeline for d1zbib_:

• d1zbib_ first appeared in SCOP 1.73, called d1zbib1
  
• d1zbib_ appears in SCOPe 2.03
  
• d1zbib_ appears in SCOPe 2.05
  
• d1zbib_ appears in the current release, SCOPe 2.08