Lineage for d1zbib_ (1zbi B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 995889Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 996085Protein automated matches [190266] (11 species)
    not a true protein
  7. 996086Species Bacillus halodurans [TaxId:272558] [188179] (2 PDB entries)
  8. 996088Domain d1zbib_: 1zbi B: [124854]
    automated match to d1zbfa1
    protein/DNA complex; protein/RNA complex; complexed with mg; mutant

Details for d1zbib_

PDB Entry: 1zbi (more details), 1.85 Å

PDB Description: bacillus halodurans rnase h catalytic domain mutant d132n in complex with 12-mer rna/dna hybrid
PDB Compounds: (B:) ribonuclease H-related protein

SCOPe Domain Sequences for d1zbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbib_ c.55.3.1 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
akeeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglr
ylkernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpi
lkwqtdkwgeikadyg

SCOPe Domain Coordinates for d1zbib_:

Click to download the PDB-style file with coordinates for d1zbib_.
(The format of our PDB-style files is described here.)

Timeline for d1zbib_: