SCOP 1.73: Domain d1zbia1: 1zbi A:62-193

Lineage for d1zbia1 (1zbi A:62-193)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein BH0863-like Ribonuclease H [142490] (1 species)
   new class of RNase H

7. Species Bacillus halodurans [TaxId:86665] [142491] (10 PDB entries)
   BH0863

8. Domain d1zbia1: 1zbi A:62-193 [124853]
   automatically matched to 1ZBF A:62-193
   complexed with mg; mutant

Details for d1zbia1

PDB Entry: 1zbi, 1.85 Å

PDB Description: bacillus halodurans rnase h catalytic domain mutant d132n in complex with 12-mer rna/dna hybrid

PDB Compounds: (A:) ribonuclease H-related protein

SCOP Domain Sequences for d1zbia1:

Sequence; same for both SEQRES and ATOM records:

>d1zbia1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikady

Timeline for d1zbia1:

• d1zbia1 is new in SCOP 1.73
  
• d1zbia1 appears in SCOP 1.75
  
• d1zbia1 appears in the current release, SCOPe 2.08, called d1zbia_