Lineage for d1zbia_ (1zbi A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2886080Protein automated matches [190266] (7 species)
    not a true protein
  7. 2886081Species Bacillus halodurans [TaxId:272558] [188179] (2 PDB entries)
  8. 2886082Domain d1zbia_: 1zbi A: [124853]
    automated match to d1zbfa1
    protein/DNA complex; protein/RNA complex; complexed with mg; mutant

Details for d1zbia_

PDB Entry: 1zbi (more details), 1.85 Å

PDB Description: bacillus halodurans rnase h catalytic domain mutant d132n in complex with 12-mer rna/dna hybrid
PDB Compounds: (A:) ribonuclease H-related protein

SCOPe Domain Sequences for d1zbia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbia_ c.55.3.1 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikadygrk

SCOPe Domain Coordinates for d1zbia_:

Click to download the PDB-style file with coordinates for d1zbia_.
(The format of our PDB-style files is described here.)

Timeline for d1zbia_: