Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein BH0863-like Ribonuclease H [142490] (3 species) new class of RNase H |
Species Bacillus halodurans [TaxId:86665] [142491] (21 PDB entries) Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193 BH0863 |
Domain d1zbfa1: 1zbf A:62-193 [124850] complexed with so4; mutant |
PDB Entry: 1zbf (more details), 1.5 Å
SCOPe Domain Sequences for d1zbfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw qtdkwgeikady
Timeline for d1zbfa1: