Lineage for d1zata2 (1zat A:217-338)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1232019Fold d.335: L,D-transpeptidase pre-catalytic domain-like [143984] (1 superfamily)
    unusual fold, made of four helices and four 2-3 stranded beta-sheets
  4. 1232020Superfamily d.335.1: L,D-transpeptidase pre-catalytic domain-like [143985] (1 family) (S)
  5. 1232021Family d.335.1.1: L,D-transpeptidase pre-catalytic domain-like [143986] (1 protein)
  6. 1232022Protein L,D-transpeptidase, pre-catalytic domain [143987] (1 species)
  7. 1232023Species Enterococcus faecium [TaxId:1352] [143988] (1 PDB entry)
    Uniprot Q3Y185 217-338
  8. 1232024Domain d1zata2: 1zat A:217-338 [124846]
    Other proteins in same PDB: d1zata1
    complexed with so4, zn

Details for d1zata2

PDB Entry: 1zat (more details), 2.4 Å

PDB Description: Crystal Structure of an Enterococcus faecium peptidoglycan binding protein at 2.4 A resolution
PDB Compounds: (A:) L,D-transpeptidase

SCOPe Domain Sequences for d1zata2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zata2 d.335.1.1 (A:217-338) L,D-transpeptidase, pre-catalytic domain {Enterococcus faecium [TaxId: 1352]}
keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
hp

SCOPe Domain Coordinates for d1zata2:

Click to download the PDB-style file with coordinates for d1zata2.
(The format of our PDB-style files is described here.)

Timeline for d1zata2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zata1