![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.335: L,D-transpeptidase pre-catalytic domain-like [143984] (1 superfamily) unusual fold, made of four helices and four 2-3 stranded beta-sheets |
![]() | Superfamily d.335.1: L,D-transpeptidase pre-catalytic domain-like [143985] (1 family) ![]() |
![]() | Family d.335.1.1: L,D-transpeptidase pre-catalytic domain-like [143986] (1 protein) |
![]() | Protein L,D-transpeptidase, pre-catalytic domain [143987] (1 species) |
![]() | Species Enterococcus faecium [TaxId:1352] [143988] (1 PDB entry) |
![]() | Domain d1zata2: 1zat A:217-338 [124846] Other proteins in same PDB: d1zata1 complexed with so4, zn |
PDB Entry: 1zat (more details), 2.4 Å
SCOP Domain Sequences for d1zata2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zata2 d.335.1.1 (A:217-338) L,D-transpeptidase, pre-catalytic domain {Enterococcus faecium [TaxId: 1352]} keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad hp
Timeline for d1zata2: