SCOP 1.75: Domain d1zara1: 1zar A:2-90

Lineage for d1zara1 (1zar A:2-90)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein)

6. Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [109704] (5 PDB entries)
   Uniprot O30245 # AF2426

8. Domain d1zara1: 1zar A:2-90 [124843]
   Other proteins in same PDB: d1zara2
   automatically matched to d1tqia1
   complexed with adp, edo, mn

Details for d1zara1

PDB Entry: 1zar, 1.75 Å

PDB Description: crystal structure of a.fulgidus rio2 kinase complexed with adp and manganese ions

PDB Compounds: (A:) Rio2 kinase

SCOP Domain Sequences for d1zara1:

Sequence; same for both SEQRES and ATOM records:

>d1zara1 a.4.5.56 (A:2-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
niaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvvq
nrqkdyegstftfiglslyslhrlvrsgk

Timeline for d1zara1:

• d1zara1 first appeared in SCOP 1.73
  
• d1zara1 appears in SCOPe 2.01
  
• d1zara1 appears in the current release, SCOPe 2.08