Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein) automatically mapped to Pfam PF09202 |
Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [109704] (5 PDB entries) Uniprot O30245 # AF2426 |
Domain d1zara1: 1zar A:2-90 [124843] Other proteins in same PDB: d1zara2 automated match to d1tqia1 protein/RNA complex; complexed with adp, edo, mn |
PDB Entry: 1zar (more details), 1.75 Å
SCOPe Domain Sequences for d1zara1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zara1 a.4.5.56 (A:2-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} niaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvvq nrqkdyegstftfiglslyslhrlvrsgk
Timeline for d1zara1: