SCOPe 2.04: Domain d1zaoa1: 1zao A:1-90

Lineage for d1zaoa1 (1zao A:1-90)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein)
   automatically mapped to Pfam PF09202

6. Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [109704] (5 PDB entries)
   Uniprot O30245 # AF2426

8. Domain d1zaoa1: 1zao A:1-90 [124841]
   Other proteins in same PDB: d1zaoa2
   automated match to d1tqia1
   protein/RNA complex; complexed with atp, edo, mn, po4

Details for d1zaoa1

PDB Entry: 1zao, 1.84 Å

PDB Description: crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions

PDB Compounds: (A:) Rio2 serine kinase

SCOPe Domain Sequences for d1zaoa1:

Sequence; same for both SEQRES and ATOM records:

>d1zaoa1 a.4.5.56 (A:1-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
qnrqkdyegstftfiglslyslhrlvrsgk

Timeline for d1zaoa1:

• d1zaoa1 first appeared in SCOP 1.73
  
• d1zaoa1 appears in SCOPe 2.03
  
• d1zaoa1 appears in SCOPe 2.05
  
• d1zaoa1 appears in the current release, SCOPe 2.08