Lineage for d1zaoa1 (1zao A:1-90)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 907111Family a.4.5.56: Rio2 serine protein kinase N-terminal domain [109702] (1 protein)
  6. 907112Protein Rio2 serine protein kinase N-terminal domain [109703] (1 species)
  7. 907113Species Archaeoglobus fulgidus [TaxId:2234] [109704] (5 PDB entries)
    Uniprot O30245 # AF2426
  8. 907115Domain d1zaoa1: 1zao A:1-90 [124841]
    Other proteins in same PDB: d1zaoa2
    automatically matched to d1tqia1
    protein/RNA complex; complexed with atp, edo, mn, po4

Details for d1zaoa1

PDB Entry: 1zao (more details), 1.84 Å

PDB Description: crystal structure of a.fulgidus rio2 kinase complexed with atp and manganese ions
PDB Compounds: (A:) Rio2 serine kinase

SCOPe Domain Sequences for d1zaoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaoa1 a.4.5.56 (A:1-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
qnrqkdyegstftfiglslyslhrlvrsgk

SCOPe Domain Coordinates for d1zaoa1:

Click to download the PDB-style file with coordinates for d1zaoa1.
(The format of our PDB-style files is described here.)

Timeline for d1zaoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zaoa2