Lineage for d1zahc_ (1zah C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834647Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 2834718Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (33 PDB entries)
  8. 2834774Domain d1zahc_: 1zah C: [124826]
    automated match to d1adoa_

Details for d1zahc_

PDB Entry: 1zah (more details), 1.8 Å

PDB Description: fructose-1,6-bisphosphate aldolase from rabbit muscle
PDB Compounds: (C:) Fructose-bisphosphate aldolase A

SCOPe Domain Sequences for d1zahc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zahc_ c.1.10.1 (C:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
hay

SCOPe Domain Coordinates for d1zahc_:

Click to download the PDB-style file with coordinates for d1zahc_.
(The format of our PDB-style files is described here.)

Timeline for d1zahc_: