Lineage for d1zaea_ (1zae A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754561Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1754562Superfamily a.251.1: Phage replication organizer domain [140713] (1 family) (S)
    DNA binding induces further oligomerization
    automatically mapped to Pfam PF06720
  5. 1754563Family a.251.1.1: Phage replication organizer domain [140714] (2 proteins)
    Pfam PF06720
  6. 1754567Protein automated matches [190518] (1 species)
    not a true protein
  7. 1754568Species Bacillus phage [TaxId:10756] [187475] (3 PDB entries)
  8. 1754576Domain d1zaea_: 1zae A: [124822]
    automated match to d2c5ra1

Details for d1zaea_

PDB Entry: 1zae (more details)

PDB Description: solution structure of the functional domain of phi29 replication organizer p16.7c
PDB Compounds: (A:) early protein gp16.7

SCOPe Domain Sequences for d1zaea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaea_ a.251.1.1 (A:) automated matches {Bacillus phage [TaxId: 10756]}
hmdktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklen
qkklyrgslk

SCOPe Domain Coordinates for d1zaea_:

Click to download the PDB-style file with coordinates for d1zaea_.
(The format of our PDB-style files is described here.)

Timeline for d1zaea_:

1754576
d1zaea_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1zaeb_