Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (5 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.1: Cytidine deaminase [53928] (3 proteins) strand 5 is antiparallel to strand 4 |
Protein mono-domain cytidine deaminase [75327] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [142830] (3 PDB entries) Uniprot P56389 10-146 |
Domain d1zabb1: 1zab B:10-143 [124819] automatically matched to 1ZAB A:10-146 complexed with so4, urd, zn |
PDB Entry: 1zab (more details), 2.36 Å
SCOP Domain Sequences for d1zabb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zabb1 c.97.1.1 (B:10-143) mono-domain cytidine deaminase {Mouse (Mus musculus) [TaxId: 10090]} vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv qellpasfgpedlq
Timeline for d1zabb1: