Lineage for d1zaba1 (1zab A:10-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918483Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2918487Protein mono-domain cytidine deaminase [75327] (6 species)
  7. 2918519Species Mouse (Mus musculus) [TaxId:10090] [142830] (1 PDB entry)
    Uniprot P56389 10-146
  8. 2918520Domain d1zaba1: 1zab A:10-146 [124818]
    Other proteins in same PDB: d1zabb_, d1zabc_, d1zabd_
    complexed with so4, urd, zn

Details for d1zaba1

PDB Entry: 1zab (more details), 2.36 Å

PDB Description: Crystal Structure of Mouse Cytidine Deaminase Complexed with 3-Deazauridine
PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d1zaba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaba1 c.97.1.1 (A:10-146) mono-domain cytidine deaminase {Mouse (Mus musculus) [TaxId: 10090]}
vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
qellpasfgpedlqkiq

SCOPe Domain Coordinates for d1zaba1:

Click to download the PDB-style file with coordinates for d1zaba1.
(The format of our PDB-style files is described here.)

Timeline for d1zaba1: