SCOP 1.73: Domain d1za6h1: 1za6 H:2-115

Lineage for d1za6h1 (1za6 H:2-115)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1za6h1: 1za6 H:2-115 [124815]
   Other proteins in same PDB: d1za6b2, d1za6b3, d1za6d2, d1za6d3, d1za6f2, d1za6f3, d1za6h2, d1za6h3
   automatically matched to d1igyb1

Details for d1za6h1

PDB Entry: 1za6, 2.8 Å

PDB Description: The structure of an antitumor CH2-domain-deleted humanized antibody

PDB Compounds: (H:) IGG Heavy chain

SCOP Domain Sequences for d1za6h1:

Sequence; same for both SEQRES and ATOM records:

>d1za6h1 b.1.1.1 (H:2-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlvqsgaevvkpgasvkisckasgytftdhaihwvkqnpgqrlewigyfspgnddfkyn
erfkgkatltadtsastayvelsslrsedtavyfctrslnmaywgqgtlvtvss

Timeline for d1za6h1:

• d1za6h1 is new in SCOP 1.73
  
• d1za6h1 appears in SCOP 1.75
  
• d1za6h1 appears in the current release, SCOPe 2.08